General Information

  • ID:  hor000723
  • Uniprot ID:  A0A8C2T2Y4(107-118)
  • Protein name:  Secretogranin 1
  • Gene name:  CHGB
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region; GO:0030141 secretory granule

Sequence Information

  • Sequence:  IHEGEEGEAEEE
  • Length:  12(107-118)
  • Propeptide:  MKGSDEEKSHPGEGNSKEDEEGRHIPVHEEKLHTEEKKQYQEIRRENSYHSEEDKENKQSDGEDHAVLNKKSHSAGMSTEEVSEENDQRPMGHWHSEEGMQSPYKRIHEGEEGEAEEERSEKYHLSESKGRDFSQHEEHEESDESEEVKEEKKSYKPKRYGKHRMGDSSEEKRGHGEDKEELAEESNTEESHLWDKRNSRQKQHHEESEQQHEEKSSYHGRHGSEGMEEKRHVGQGSVEYRDRWQQSEEKSQEEN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000723_AF2.pdbhor000723_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 155369 Formula: C54H80N14O27
Absent amino acids: CDFKLMNPQRSTVWY Common amino acids: E
pI: 3.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -185 Boman Index: -4372
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 40.83
Instability Index: 8838.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon